PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv1_019810_cgkm.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family MIKC_MADS
Protein Properties Length: 221aa    MW: 25330.7 Da    PI: 8.826
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv1_019810_cgkm.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF96.21.4e-30959151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        krien + rqvtfskRrng+lKKA+ELSvLCdaeva+iifs++gklye++s
  Bv1_019810_cgkm.t1  9 KRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFAS 59
                        79***********************************************86 PP

2K-box84.13e-2883173999
               K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                           e+++++l++e a L k+ie  + ++R+llGe+L+s++++eLqqLe+qLe+s++kiR+kKn+++ eqi++l++kek l+ en++L++k+e
  Bv1_019810_cgkm.t1  83 SREENMQNLKEETAILVKKIEAVEASKRRLLGENLGSCTFEELQQLENQLERSVSKIRAKKNQVFNEQIKQLREKEKHLSAENTRLTEKYE 173
                         67899**********************************************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.581161IPR002100Transcription factor, MADS-box
SMARTSM004322.2E-40160IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.83E-32373IPR002100Transcription factor, MADS-box
PRINTSPR004043.6E-31323IPR002100Transcription factor, MADS-box
CDDcd002651.61E-41375No hitNo description
PfamPF003195.3E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004043.6E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004043.6E-313859IPR002100Transcription factor, MADS-box
PfamPF014863.4E-2784172IPR002487Transcription factor, K-box
PROSITE profilePS5129715.3688178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000060Biological Processprotein import into nucleus, translocation
GO:0009409Biological Processresponse to cold
GO:0009739Biological Processresponse to gibberellin
GO:0009911Biological Processpositive regulation of flower development
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    Send to blast
MVRGKTQMKR IENATSRQVT FSKRRNGLLK KAFELSVLCD AEVALIIFSP RGKLYEFASC  60
SMQETIGRYQ RHIRDVQPAK DASREENMQN LKEETAILVK KIEAVEASKR RLLGENLGSC  120
TFEELQQLEN QLERSVSKIR AKKNQVFNEQ IKQLREKEKH LSAENTRLTE KYETLPNEAQ  180
TQPITTEDAS PSEDTTSQIS DVETDLFIGL PESRIRRLGN A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3p57_J4e-19372271Myocyte-specific enhancer factor 2A
3p57_I4e-19372271Myocyte-specific enhancer factor 2A
3p57_D4e-19372271Myocyte-specific enhancer factor 2A
3p57_C4e-19372271Myocyte-specific enhancer factor 2A
3p57_B4e-19372271Myocyte-specific enhancer factor 2A
3p57_A4e-19372271Myocyte-specific enhancer factor 2A
3kov_J4e-19372271Myocyte-specific enhancer factor 2A
3kov_I4e-19372271Myocyte-specific enhancer factor 2A
3kov_B4e-19372271Myocyte-specific enhancer factor 2A
3kov_A4e-19372271Myocyte-specific enhancer factor 2A
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00076ChIP-chipTransfer from AT2G45660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1691735e-50AC169173.3 Medicago truncatula chromosome 7 BAC clone mth2-107b13, complete sequence.
GenBankAC1840475e-50AC184047.1 Medicago truncatula chromosome 7 clone mte1-40a8, complete sequence.
GenBankBT1432165e-50BT143216.1 Medicago truncatula clone JCVI-FLMt-5J8 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010692327.11e-161PREDICTED: MADS-box protein SOC1
RefseqXP_010692328.11e-161PREDICTED: MADS-box protein SOC1
SwissprotO646455e-88SOC1_ARATH; MADS-box protein SOC1
TrEMBLA0A0J8BJC11e-161A0A0J8BJC1_BETVU; Uncharacterized protein
STRINGGLYMA18G45780.15e-95(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.15e-81AGAMOUS-like 20